DPCstruct | MC28244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 251 ± 50 aa |
| Standard deviation of domain lengths | 50.30 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A654CJM5 | 1-154 | MIDQKATRQLMLVRYYLTLADAQQRVGSDPAHFTAINLLHEALEATLIACSDHLNLDVSEKSTIENYLNKIDQSLDGVNTPYRTRIL… |
| A0A2S6N1L2 | 2-242 | RRLTIVRYLYNQALEQERKGDLVGGLALLPFHDAVELFLQVAAENHPEVKLTKSVEFMAYWPAFATAGLTLPYQEQMRRFNNARVEV… |
| A0A7X9DEJ1 | 1-357 | None |
| A0A830F7V3 | 3-231 | None |
| A0A1C4PL00 | 11-273 | None |
| A0A7W4I7K4 | 26-314 | None |
| A0A0F9AN13 | 51-337 | None |
| A0A7W1D9X3 | 2-202 | None |
| A0A1S6S054 | 54-337 | None |
| A0A4R8VGK8 | 30-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.