DPCstruct | MC28241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N0QM52 | 1-98 | MFCMLLRKHIEGGFIQAIQNQSFERVVTFSIESKNEIGDTVYRNLTIEIMGRHSNLLLIDSQTDKIIDSIKHLPPSVNSYRTVLPGQ… |
| A0A352MXT0 | 5-92 | FCMLLRKHLIGSKIRKIYTNGLERIVIFELECYNELNDLVNKKLVLELMGKHSNIILVNENNRIIDSLRHLDTYSKSYRNILPAHEYV |
| A0A1W1CE89 | 1-87 | None |
| A0A824C526 | 52-156 | None |
| A0A2V8MML4 | 59-163 | None |
| A0A2V8QIV1 | 70-174 | None |
| F9MS67 | 2-94 | None |
| A0A5S9M8N4 | 13-112 | None |
| A0A830Z0E9 | 59-169 | None |
| A0A7J3NPU2 | 186-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.