DPCstruct | MC28240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 165 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E2B6I6 | 88-244 | QPDRAALEAAVRRWDFSENEWICRDLLIAAFPDTVGRWTVEELLKMDTMELLLETGEQDPNTAIQMMKLLLDTAEEHLQETEAAEQL… |
| A0A1Y4M1F3 | 1-153 | MVRRWDFSENEWACRDLLIADFPDAVRRWTAEELEDMDTQELLYETGDSDPQTAVQMMKLLLDTAESHLQEPEVAQQLLGWDMCDLC… |
| A0A1Y4WH45 | 151-309 | None |
| A0A416RCI2 | 118-278 | None |
| R5ISB7 | 218-376 | None |
| A0A1Y3RFR9 | 1-181 | None |
| A0A417HNI9 | 47-217 | None |
| A0A416Z7U1 | 178-334 | None |
| A0A1Y4UQ49 | 117-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.