DPCstruct | MC2824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 60.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4R8J5 | 1-92 | HVKMGTCEVVEAHRCCNKNKIEERSQTVKCSCLPGQVAGTTRARPSCVEASIVVQKWWCEMKPCLEGEECKVLPDRGWTCSNGNKVK… |
| A0A7N4PVX0 | 276-403 | FRSWSTGVCLLVLCLATLWARLAFASSHPRTHAVHVEPGTCEVIAAHRCCNRNRIEERSQTVKCSCFPGQVAGTTRAKPSCVDASIV… |
| A0A4U5UQ07 | 137-245 | None |
| A0A835NEU0 | 12-133 | None |
| A0A3B5Q2Z9 | 15-137 | None |
| A0A556UG53 | 322-441 | None |
| G3IDS6 | 24-124 | None |
| A0A4U5U9K6 | 43-175 | None |
| A0A3Q2H1Y1 | 101-222 | None |
| A0A2R8QI81 | 4-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.