DPCstruct | MC28237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 616 ± 104 aa |
| Standard deviation of domain lengths | 103.57 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V4JS93 | 30-765 | GAEAALLPRPEVQSRLAVPPSADRERPAEIRLGGASTGAVTLSLAELGYDADETLRGAVAVREYQIILPLRSKLLAGSRFFLHFSHS… |
| A0A447W3J8 | 1-454 | MLNGQPLGTLPLGADGEDVSHYQLDIPPALMVSSNNLSVKINDGDTLQCQRDIHDTSRVTVLPTSHFSWESQQLNISDDLSHFPRPF… |
| A0A6J7IL25 | 1-627 | None |
| A0A838RMD7 | 216-907 | None |
| A0A410Q1L1 | 24-751 | None |
| Q5SKA3 | 29-501 | None |
| B1H9R9 | 191-942 | None |
| A0A1Y4E035 | 23-769 | None |
| P0CW87 | 773-1488 | None |
| A0A0N1F9E8 | 308-983 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.