DPCstruct | MC28235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9Q0F0 | 1-82 | MATRQSFTDSDTADEAVRATCDDASICKRFATSKSYWKDPYIQYFVRQIGERKAPEINRGYYARVQGVNHLLDSFLRKNKTM |
| A0A813UE23 | 1-70 | MTSNTEEIDNTAIIETNTDSSSCKLYAVDREYWVDPYMKYFTMKHERKTPEINIGYYIRVTAIRKFIEKF |
| A0A3B4GBU8 | 7-76 | None |
| A0A0A9YZU6 | 4-68 | None |
| A0A4U5NDN1 | 20-98 | None |
| A0A1A9WVZ7 | 21-92 | None |
| A0A0N1IHZ7 | 1-73 | None |
| D3B335 | 21-99 | None |
| A0A480KR04 | 9-88 | None |
| A0A2P2LLL1 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.