DPCstruct | MC28234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 7.85 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9DAT3 | 152-269 | RDDIVFKSGWRKTVKLQDLIRAKVIEESRVVELEEQVITEEEVERELRPFLIGQYPIAGIFNDQTGQKMSLFDAHKQRIISRGTALS… |
| A0A0E9PSK5 | 1-113 | MTCDMIRRRVTIEELYSARIIDLETYNLLKQEKKTIREVMEMPNVKKYLFGTGSIAGVMADSSSKIGLYHAMKRGLLKPEIALSLLE… |
| S4R905 | 562-673 | None |
| A0A6P9AZ78 | 619-737 | None |
| A0A0E9WH96 | 89-185 | None |
| H3CB78 | 444-556 | None |
| A0A6G0HU46 | 151-262 | None |
| A0A6G0HTZ7 | 121-234 | None |
| A0A226MWR4 | 246-365 | None |
| A0A3M0LAH0 | 677-800 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.