DPCstruct | MC28233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 118 ± 9 aa |
| Standard deviation of domain lengths | 9.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.72 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF02825- CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8QUW5 | 787-902 | SQTYELRLKDMVQKNLESGTERKVCRRPKFVSKEDVKSKKSGKSKSPPDTEPIPSHWDSAQTPDLGFKLVTLDPTSSEHNKVKDLFH… |
| A0A0E9PPR0 | 1-103 | MTQRNLKYNTKREVRRRPRFLSGKDVEKKLKSGTPEASGSSATSVPKHWDQEALADFEYKLICLSATSTEFQQVQKLFKRTMPTSTV… |
| A0A0S7FD02 | 121-247 | None |
| A0A060WXS7 | 242-369 | None |
| A0A6P4ZDS8 | 116-224 | None |
| A0A4Z2BHE1 | 33-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.