DPCstruct | MC28231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 197 ± 18 aa |
| Standard deviation of domain lengths | 18.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4G5M1 | 4-198 | LPRIVVENEPARIYHIHTFGGWTIDIDFNLPESSQPELERLTALVGTLVEAECPAAKCFGVTGVGEGIVWNCVTAGYTNLKFKVKGE… |
| A0A1E1K9Q8 | 335-529 | WLDDQPYADIEDEDAGIVHVARGGFFEEELDVTDLESCQERTMALTLGIADTCPFAQSFGITGRGEGVVWKAAHPLGKDSRFWIKTK… |
| A0A815SCK6 | 16-205 | None |
| A0A5C7J669 | 14-215 | None |
| A0A2S9XXM2 | 2-151 | None |
| A0A3B8LSB1 | 233-444 | None |
| A0A819S253 | 135-364 | None |
| A0A815MGG9 | 20-212 | None |
| A0A2D2DRD2 | 24-225 | None |
| A0A3L6VRL8 | 53-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.