DPCstruct | MC2823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Standard deviation of domain lengths | 9.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14934 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4Z1L3 | 6-115 | FVRVSYLTLVLVPCIWLLYTFAVYAPQSVPWSMLGPVGTLVQYLIKNYPVQLYRGFWIAWGIHTTEAVIAAILTTMKNIGGVTRLKW… |
| A0A7N4PTE6 | 93-201 | YFKRGNLFSLIVIVVSFSYYTWVVFWPQSIPYQKLGLLGHFTQYLVDNHLALMRNGYWLAWLIHVGESIYAMILCNQKGITSGRAQF… |
| A0A2B4RQ70 | 20-134 | None |
| A0A0N4V4B9 | 2-102 | None |
| A0A821KA68 | 114-220 | None |
| A0A821JPD3 | 21-150 | None |
| A0A835P8I8 | 37-168 | None |
| A0A7J6CHY0 | 2-104 | None |
| A0A3Q4HVT8 | 7-123 | None |
| E1BZD7 | 9-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.