DPCstruct | MC28228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4Z6E8 | 276-412 | PVYHLLVESLEMYQVNAGLTENPLSVPIKPPVQVTTWAGCIIRFAAAMTPPLKLDCKWKQPPAALAKRSNDRPLLHYTRQELRPKLV… |
| A0A225UXB4 | 236-369 | AYHLLVESLEMYQVLAGLTGHPLEFLLEPPSHLQGWIHQTLRAAARLGVKASVEWTNPAQCVSERPNDRPIWGSVCVSTQQKILRFN… |
| A0A396ZSR6 | 277-452 | None |
| A0A833SSV7 | 145-281 | None |
| A0A225WA52 | 296-430 | None |
| W4FAH6 | 193-365 | None |
| A0A225W2C1 | 342-471 | None |
| A0A225UQ23 | 67-203 | None |
| A0A397FNR0 | 230-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.