DPCstruct | MC28226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I1HJ03 | 156-231 | GTTDLILVESHSVDALVKKAGVRAVIELKKIVKSSHIKQIILEMIAADLFVRDEIKVFGLLTDLKSAWHFFWLEEG |
| W4FG18 | 1-93 | MTGAADMLLVKRRGLASNPLAGVMLVIAIKKGVQPSHSGQALGQLERLSASPKAPLHCYPMSLLTDLNNHWEFTWFNDDHFVGSAGS… |
| F0WQ98 | 26-123 | None |
| U9TNN8 | 91-168 | None |
| A0A6G0RTJ9 | 247-323 | None |
| K3X578 | 1-85 | None |
| A0A662Y1B7 | 160-237 | None |
| A0A2N0NR12 | 206-292 | None |
| A0A6T5TRV8 | 13-95 | None |
| A0A6G0W4V7 | 235-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.