DPCstruct | MC28219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 131 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A163DXK3 | 152-273 | SRRLTHREVRNSLKTLGVDTGRILDINFPAKDVVDILVHNQYAEKFQTTLTTVAIEILDAFDPLDPKNIADPKYKSLSDSELEEVAA… |
| A0A1R1YPH3 | 376-511 | TAAEKTHKLSRIFIQGINRMPYRDLKRNLFALRFQLSRIFSIDFIGTRTVEFVVEASYAKSFTKKMESYEYFKVLKDVNPALPSEKN… |
| A0A0B7N3I6 | 149-270 | None |
| A0A0B7NXD2 | 137-271 | None |
| A0A0B7NY50 | 724-835 | None |
| A0A1Y1VYX6 | 263-440 | None |
| S2JGX7 | 5-115 | None |
| A0A167NAS4 | 361-484 | None |
| A0A1R0GN25 | 416-555 | None |
| A0A1R0GQC1 | 363-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.