DPCstruct | MC28217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 3.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2K614 | 1-49 | MRRQKRDMSDRAFHKGYQAGFSGRNKEMCPHQQETLRQNWLTGWREGRQ |
| A0A1X0W8S3 | 1-54 | MKRQKRDRLERAQSRGYQAGIGGRSKEICPYQSLDQRSHWLGGWREAMEVRAVN |
| Q2NU75 | 1-49 | None |
| A0A1N6ERN3 | 29-80 | None |
| A0A0Q9YN00 | 1-55 | None |
| A0A1G9JW83 | 29-88 | None |
| A0A2E2TX99 | 5-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.