DPCstruct | MC28214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 153 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5WK20 | 1-104 | MLPVSSALLSPGNIAPRALNMPGLRPFFLLGGDPRSLSWLRENAARLRAMGAVGLAVEVADSEALSRIRATAPDLVIVPVNGDDIAA… |
| A0A1X0VVT7 | 11-144 | IFFTGITQGDATLIINVNAHAEAAMLPVSTPEMTPGIVSDRPLNLPGIGMLFLLGDDPTSVAWLTKNALQLKRHRAEGLAVNIKDID… |
| A0A0Q4XQE2 | 1-174 | None |
| A0A7I8MI05 | 19-149 | None |
| A0A2E0Z147 | 29-199 | None |
| A0A420S100 | 807-964 | None |
| M4UBE7 | 224-356 | None |
| A0A193KIH4 | 67-235 | None |
| A0A431J9B7 | 271-438 | None |
| W0DX02 | 19-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.