DPCstruct | MC2821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 115 ± 13 aa |
| Standard deviation of domain lengths | 12.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J7EPN9 | 2-128 | WEERMSTFNKIVREVAEKFNLLVMDASMDPDSSNPNLLAFDRLHLNAAGHYRVAQAVLEHIGAPFDPSWREPVVAPKKFPWIIRTLI… |
| A0A6J6J1P3 | 19-145 | WKERFAEFNKAIREVGQEVGAIVSDANDLDFFKDNRFLAFDRLHLNAEGHWRVSQGVLEVLGYPSNPAWRIPLPPAKKTPWLKERYI… |
| A0A2P6G3G8 | 132-262 | None |
| A0A0K2RLB3 | 49-141 | None |
| A0A1W7D4R2 | 133-247 | None |
| A0A7J9V953 | 39-149 | None |
| A0A7X6H6V0 | 1-106 | None |
| A0A1X1XIB4 | 23-147 | None |
| A0A0A0JB71 | 6-98 | None |
| A0A7K2QBF4 | 88-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.