DPCstruct | MC28209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 233 ± 25 aa |
| Standard deviation of domain lengths | 25.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661IQ63 | 273-486 | LISSMSLQIGDILELKNSKKLNKLNIYDSIARLSAKISIPKSPEIPNLVQSEYETTVAFNKRVEDVRLKREATIRNLNKEYALEMQE… |
| A0A1V1P0X3 | 20-225 | LGIDDAIKEIKEINRALNKLETEFSAEITRQVKPVRQFYVSKMNKVYNIGIHPKSMYETDSDYKKRVAQFDSQISKIKSKIKSEMNL… |
| A0A0R2BFU7 | 1-213 | None |
| A0A1F9MMH7 | 357-611 | None |
| A0A2S7UWU1 | 51-315 | None |
| A0A062X0X6 | 166-379 | None |
| A0A482ZZZ2 | 55-276 | None |
| A0A1W1DZM9 | 2-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.