DPCstruct | MC28208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 298 ± 52 aa |
| Standard deviation of domain lengths | 52.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A414CBN2 | 92-315 | SDAYERAVECEKLVSGLEAGALSGLAGYYLKTDMSAKSLLAEINEVLDSVAESYPVLLNGFTFLVAGDAYDLEKYGTFCCTPSDIEK… |
| A0A2M9YCD2 | 4-355 | EDFTIRIFLNFLRSVGITVENDILGVVRNVILPQSDIPLCLTGICYEIALHEPGKFYNRKVADELNSKFKTAYDTDSNIFLKGMQSA… |
| A0A841D7K6 | 113-432 | None |
| A0A1L8QMY7 | 3-376 | None |
| A0A5C8QCE0 | 208-551 | None |
| A0A3D5TM36 | 137-442 | None |
| A0A371J3X6 | 19-357 | None |
| G2E4I2 | 42-280 | None |
| X1AKJ2 | 3-219 | None |
| A0A7T9TNL0 | 86-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.