DPCstruct | MC28207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 164 ± 23 aa |
| Standard deviation of domain lengths | 22.77 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3D7E0 | 3-105 | EPEIRSDNGGRGIRNAETNFYADAETRTLVTTLNGVEVELRATPVSFHWDYGDGSPTKTTSVAGQSQPEFNVPTPTSHVYEDTGQYT… |
| A0A7W3XVA9 | 44-229 | NIPFWVETGEVPDVERALSPLILAELAYERIRVPETNITLSPEREDRQVVNLPTWIWADTGDFSPVAVTASLDGWDIWATTTARPVA… |
| A0A3A1TWY2 | 47-197 | None |
| A0A7Z0IHZ2 | 29-187 | None |
| A0A7V5EWL0 | 30-202 | None |
| A0A3C1DTB3 | 243-400 | None |
| A0A251XSY0 | 10-135 | None |
| A0A2H5YJG3 | 406-540 | None |
| A0A2E0RWD5 | 134-323 | None |
| A0A2W6AL21 | 4-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.