DPCstruct | MC28206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 13 aa |
| Standard deviation of domain lengths | 12.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2C017 | 3-138 | IVKLINNFKCPLINGIFFPNGDILVIEKNNVSIRVVCKTTVESYFLYNSVDYVTEFDILVRNSNNKYTVGGGEGSWGGDGIILLEDN… |
| A0A7W3T0V9 | 1-139 | MNRMVGMWREGRLFIRDALHSVSTGTSFAVAVDPGAPGGLRFGDTFDLDAEAVADPERFTSIDVTGSHPLPDGGALRWGEGSHGSEG… |
| A0A3P1T8J3 | 9-168 | None |
| A0A5B8XY79 | 14-142 | None |
| A0A3C1ZV88 | 12-140 | None |
| A0A1C4WFX8 | 5-145 | None |
| A0A7H8PII5 | 166-317 | None |
| A0A7Y7AEW9 | 5-149 | None |
| A0A062TYR3 | 118-265 | None |
| A0A4D4KUN6 | 2-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.