DPCstruct | MC28204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 135 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C1F421 | 138-268 | LTTLGTPYDFGDYRSETLTTKAWNALAQTDDKGVELYVKKCVSLYEAKAKEQQAGLADFATNDKVFDSWALNDVATCYFILGESLLQ… |
| A0A4D9CMV4 | 178-317 | PVKPTLPQDKNQLIELAWSSLIKVEETKNIDDANKGIEYTNECIDRFQQDADNIQAKLKEQNEPIPPVGIVSKEENQIINGRGALND… |
| A0A3M0YYW6 | 1-151 | None |
| A6DNB2 | 305-428 | None |
| A0A4Q2XYT5 | 3-128 | None |
| A0A4Q2XHY4 | 41-177 | None |
| A0A3C0MXS1 | 49-181 | None |
| A0A2E6TJ38 | 13-142 | None |
| A0A450XC56 | 78-224 | None |
| A0A1W9RK88 | 8-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.