DPCstruct | MC282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 452 ± 33 aa |
| Standard deviation of domain lengths | 32.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4EQS4 | 190-628 | TQVRDEIVQIVEEAGGVIAATGVAEALLASRSPEAAGERWMRRALGLVRAAVEVETERGGEARLLQRHSHESVIVALEKPTDPEAVP… |
| A0A6J7JY00 | 1-390 | MLWQRTATGRVLVVRIEGDLSLAQRRLDAASALGSRADALVDESELLPFPRTTAALRSVAMPSDAPALGSERLVRLATSSSARAGVS… |
| A0A060ZUQ2 | 1-502 | None |
| A0A1S9D0C2 | 628-1083 | None |
| O86560 | 1060-1557 | None |
| A0A418N0Z8 | 247-716 | None |
| A0A846AKJ1 | 56-471 | None |
| A0A1C4VMA5 | 147-603 | None |
| S6SF95 | 473-929 | None |
| A0A6N7EEQ2 | 434-864 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.