DPCstruct | MC28196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 208 ± 29 aa |
| Standard deviation of domain lengths | 28.51 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.72 |
| Pfam Score | 92.98 |
| Assigned Pfam label(s) | CL0023- PF12462 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4A2K7 | 92-291 | QQSLIQLIVKIEPFISRQYLRQSVLKRLLKAVTLEYEKWFPWVLSAKRVPISLAPYLEKLSRYRHWQVAQINAFRDAYIKQQLQQYQ… |
| A0A6S4RNR2 | 83-303 | VQALNVTLKEKRLREDVAFLKDQQVTIDAWLDHKAEQERSCFEQRRWFTHEQQEDVLAARPTVDPAALRSRLKKPGVAIRLGPAAQA… |
| A0A379UMR5 | 1-173 | None |
| A0A6A8G4N9 | 354-577 | None |
| A0A3B8SLD3 | 7-181 | None |
| R5LST5 | 6-257 | None |
| A0A6A2FBZ9 | 78-286 | None |
| A0A397WCH8 | 37-270 | None |
| A0A0A2UWQ2 | 110-331 | None |
| R5ZD39 | 125-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.