DPCstruct | MC28194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 140 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7FZX0 | 33-186 | VVCDSQVVMKMVADTPPSVRCTTFSILLARFKGDLVTLARGAARIEALRPGGRVLIAESCSHHAAEDDIGRVKIPRWLRQFVGGDLD… |
| A0A7V3CVV5 | 2-138 | LTTFSILMARYKGDLKEYVKGLVRIEELQNGDKVLIAEACTHHAQEDDIGKIKIPRWLRLHTKKYLEIDNVNGFDYPENLREYKLIV… |
| C0JZY6 | 226-355 | None |
| A0A380PZJ9 | 2-112 | None |
| A0A7X7IL67 | 187-323 | None |
| A0A2M7PIP6 | 147-284 | None |
| W7TDJ2 | 77-262 | None |
| A0A7C7D411 | 45-181 | None |
| A0A645JCP6 | 5-111 | None |
| H1DAD1 | 101-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.