DPCstruct | MC2819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3267 |
|---|---|
| Mean domain length (aa) | 360 ± 72 aa |
| Standard deviation of domain lengths | 72.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.34 |
| Mean intra-cluster sequence similarity (%) | 11.45 |
| Pfam Score | 82.18 |
| Assigned Pfam label(s) | PF18951- PF00057- PF21307- PF11945- PF13968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J6SDC9 | 162-511 | LWLGLDGLKMQGTNGSQLWDTAFAVQALLEAGAQNIPAFTDCLNQAHAYFEVTQVRDNPPDYDKYYRQMNKGGFPFSTRDCGWIVTD… |
| A0A2V9RPT7 | 32-379 | TKERVRAAVEWILRAQDAAGDGGVSMGYFPCENPGAWKTSYPETTGYIISSLLEFARCYRDEKVRQRAIKMAEWEIKVQMRSGAVQG… |
| A0A446JWE7 | 119-438 | None |
| A0A7S3ZNW7 | 199-630 | None |
| A0A258RJ95 | 102-513 | None |
| A0A819NIU7 | 149-549 | None |
| A0A7V2UZ23 | 166-505 | None |
| A0A7V3ADK9 | 34-365 | None |
| A0A1G0ZRX3 | 59-490 | None |
| A0A1V2LS39 | 37-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.