DPCstruct | MC28179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 13.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3UIF9 | 1-119 | RKLVHVCSLEPEKRANAACLAGCFQIILLGRTARDAWSRFAKVRQPFLPFRDATYGATSEKLEISVVLRGLEKAIRLGWFDYHKFDA… |
| A0A196SK27 | 62-190 | CRVVSLKLKSSRFKSKRLYYYSRRNPSFMANSILLICCFTMVEKGLSAEEAFHPFEGVELPSYHDASDGICDFHLSVLHCLSGLNKA… |
| A0A5J5D4I3 | 22-130 | None |
| A0A0A9XW90 | 15-148 | None |
| U6N7G3 | 632-754 | None |
| A0A5D6XLT4 | 106-206 | None |
| A0A3P6UC79 | 1-117 | None |
| A0A4U5TXS1 | 67-194 | None |
| A0A2I4ALZ1 | 2-102 | None |
| A0A368F7M2 | 76-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.