DPCstruct | MC28177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 179 ± 33 aa |
| Standard deviation of domain lengths | 33.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A563VJB3 | 376-548 | NNFNADIDAINDIKTKYKIRDRLLRIRELNSTLEFVKCEKEVHSNNLKKVDSLMPEILAKMLTKYYSGEGAKITDLVTNENEICRVK… |
| A0A0A1VUE1 | 15-177 | CQIVFDELKTREFTNTFYRNLILIDDSMPIIVANLLLNAYSGENNKSIIKLHEKMTMDNPCGYELQNVGEIYERKIKNFLTDITLGL… |
| A0A7C3GYN2 | 327-522 | None |
| A0A2A4R438 | 86-263 | None |
| A0A2M6W3V3 | 191-362 | None |
| A0A1J1DX02 | 14-171 | None |
| A0A6B9TER4 | 54-264 | None |
| A0A1I1NX13 | 4-116 | None |
| A0A6B9TA74 | 189-400 | None |
| A0A7Y0IKS1 | 3-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.