DPCstruct | MC28176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 86 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A450WEW2 | 51-119 | AHENYGQIATYSGTIPGHPHRFELDNHYEFVTGKPVSVCGNIASMLQNTRYAKHWIVSGDRSVHYGAFD |
| A0A140E556 | 1-82 | MQTFYCLTFLHSLDQHPHSFNLDDHHHFETGRPLRVCGNTADMLAGSRYGDHFQVLGDKSRHFGLFDCSPGPGSESAKADSA |
| A0A329P3Z0 | 69-158 | None |
| A0A2N0P7Y6 | 247-314 | None |
| A0A354B3N1 | 11-102 | None |
| A0A2H5SG62 | 107-174 | None |
| A0A835XSA4 | 289-381 | None |
| A0A831ZC33 | 49-133 | None |
| A0A6P4ZR72 | 84-161 | None |
| A0A813G3L7 | 259-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.