DPCstruct | MC2817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 199 ± 21 aa |
| Standard deviation of domain lengths | 21.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7R478 | 29-188 | GGGCYCPENLAEERESKLAIDVFEKLKDLQCPLMRGLHIKQPETVKQLLCTPSKYRMDILQWMYTRACPSSAPVLNPASRTPEEAKI… |
| A0A1A8CGC7 | 1-212 | MAGPLTEEQVARQLYDALQAAACPLVQGLYLKEDDSMLELLCSPSELRTDILAWICSRIDPNVANSKAARSHDPHALTKEMAAFGHE… |
| Q4T950 | 1-208 | None |
| A0A6I8R0C5 | 3-200 | None |
| B3RWX5 | 1-200 | None |
| A0A6I9NSZ0 | 2-170 | None |
| H2L9G3 | 4-200 | None |
| A0A6J0CIH3 | 27-243 | None |
| A0A553QKV9 | 1-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.