DPCstruct | MC28168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 196 ± 17 aa |
| Standard deviation of domain lengths | 17.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4X0M8 | 2-162 | TAMWVHRNQSNEITQVTGDLDKGPVNHVIIHDPRIIRSLGLDEPPFDTITLQSPSRVDETYDIRILPGQNPQDLDSWVVGELVSARH… |
| A0A6A5R5T3 | 2-193 | ITLAIPVTNPSAFPVERFREVQEGRQPSTRIVDMLVYKASSGPITKVTADIQDGSINHLFIRDPRVIDALGFAAPYFDTINLDTNKL… |
| A0A2T2P6P8 | 23-226 | None |
| Q0U1M8 | 254-469 | None |
| W7EHL7 | 223-414 | None |
| A0A6A5Q763 | 4-173 | None |
| A0A364NGP1 | 611-823 | None |
| A0A178ECK1 | 79-280 | None |
| A0A4V1WXQ4 | 778-992 | None |
| A0A1Y2MBZ2 | 85-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.