DPCstruct | MC28167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 150 ± 16 aa |
| Standard deviation of domain lengths | 15.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B1B4K2 | 11-152 | LLLLLSLPMAQAEIYKWVDEQGQVHYSEKPPKEKHPATEIRIRTYTPHAPLISPKQRKQQRDNLLRAFQEERQIRNEAKEKKEQKEA… |
| A0A1T5BXR4 | 17-174 | VACVARGPVILLAPSNHLPESRMRRCLVLALLVTACPLALAQAYKWKDAQGVTHYADTPPPNNARYEKVKTSGTVEAPAPAPAAPAK… |
| A0A7C3CWE6 | 5-168 | None |
| A0A2L0PMW9 | 1-159 | None |
| A0A829YDZ2 | 1-134 | None |
| A0A259QMD8 | 1-166 | None |
| A0A534CDG7 | 10-148 | None |
| A0A2G2QQ24 | 70-223 | None |
| A0A4R2MVL0 | 15-170 | None |
| A0A559QHH2 | 28-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.