DPCstruct | MC28161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 124 ± 27 aa |
| Standard deviation of domain lengths | 26.70 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7EU33 | 10-114 | TKGSLVHGTLTTGSVSITADMVPFFRLIGYYHGNNGDIIADSVWVDVRDECEIKVTVQHNTQPVVGKPLDLEIDLHGQDATVALLAV… |
| A0A1W4VYK4 | 12-131 | VQVDPTFDMVPQATLYVHYVVDGVLRSDKATVNFEKDFGNTIEISAPKEAKPAEKVNLRITTDPHSFVGLLGVDQSVLLLRSGNDLN… |
| A0A7D9M723 | 1-89 | None |
| A0A7D9M6E0 | 1-86 | None |
| A0A6S7IEF1 | 263-363 | None |
| A0A212CDG7 | 411-563 | None |
| A0A2G8LCE3 | 12-140 | None |
| A0A2G8LHW8 | 74-190 | None |
| A0A6A5FR55 | 120-235 | None |
| A0A6P8GKT7 | 397-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.