DPCstruct | MC2816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 54 ± 4 aa |
| Standard deviation of domain lengths | 4.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 62.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2L3C8 | 5-57 | RNTGREVKWLRHYSSAQSILIVGDGDFSFSLALATAFGSGVNIVATSLDSYGK |
| A0A2I0VZM4 | 2-47 | AEAMWINCYCSAQKILLVGEGDFSFFLYLATVFGSAFNIVATSLDS |
| A0A2K2CCX1 | 128-181 | None |
| A0A218XLT3 | 1-50 | None |
| A0A438G556 | 45-102 | None |
| A0A7J6XBV3 | 145-197 | None |
| A0A4S8J7C7 | 16-70 | None |
| A0A498IWY8 | 2-50 | None |
| A0A2J6K8R4 | 12-66 | None |
| A0A6A1VR22 | 11-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.