DPCstruct | MC28159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G3CZ35 | 1-66 | APRLATRNTHGTGCSLASAIAAQLARGAGTEQAVARAHGWLHSAIAAADRLEVGRGHGPVHHFHEV |
| A0A0X8JV96 | 15-86 | KIFNNNTHGTGCSLSSAIASNLAKGYSMLDSVKKAKNFVLCSIRNSVDFGEIGGTVNQMGEIYKNIDIEKLY |
| A0A380P339 | 154-227 | None |
| A0A0B3S2Z9 | 46-111 | None |
| A0A7J2N050 | 1-56 | None |
| A0A7V4Q6R7 | 98-158 | None |
| A0A1Q8YCF1 | 29-92 | None |
| A0A146H6N1 | 661-723 | None |
| Q2U072 | 114-176 | None |
| A0A549YEU8 | 28-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.