DPCstruct | MC28158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 330 |
|---|---|
| Mean domain length (aa) | 147 ± 31 aa |
| Standard deviation of domain lengths | 30.76 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.13 |
| Pfam Score | 89.47 |
| Assigned Pfam label(s) | PF10748- CL0655 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W7QPL7 | 2-85 | LPIQSFEVTKFKVAGIIAGLRENQALVIDPNGKGYVVRAGMAIGNANGRISRITSSSVEVVERYRDGGGRTKSRTIVLTLPKKR |
| A0A6I0E8W5 | 28-167 | WTAIDAGPIFPAAVPKTLQTDSPGSNQGVEALDASVDSSVVTERPLFIATRRLPAKVAAAAPITAKSDLPAAQFKLIGVLVSGGTRQ… |
| A0A1F6RHN6 | 143-268 | None |
| A0A3D6A667 | 1-185 | None |
| C6XET1 | 5-148 | None |
| A0L661 | 1-192 | None |
| A0A1Z9QQ43 | 20-171 | None |
| A0A7Y2JJL1 | 361-497 | None |
| A0A4Q2XML1 | 28-203 | None |
| A0A7X1B035 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.