DPCstruct | MC28156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B3UJM0 | 1-106 | MDVSKLHNNGVPPAFRGSALDQTAPVSGASSTETSGVRADFDKIAHKTPAERMRDALLKRLGYTEESLKDLSPEKREAVEQKLQQML… |
| A0A4Q3US80 | 1-118 | MDAATLLALQGDDAGKAGQADDALLDGAKADGESGAVEDFLDYMKKTPEERLRDKILKALGLTEEDLQNMSPDERLGIENKIRDIIK… |
| A0A2K4ITE9 | 1-134 | None |
| A0A2A5H500 | 47-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.