DPCstruct | MC2815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 14.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3YGP7 | 123-254 | SVLKRDTVVFWNNERYHLYIAINPTKYKVTRHTLNEDGLDVENVYYDNIIHLSIFRGDRQLFSKDFRKQQYQKRVPEQLLAQSVLND… |
| A0A644Z4M7 | 1-127 | MQVSKSETDIQFKGKDYHIFLSRTPSDSLPHVNTEMGDEYLDNQIVLKITRGNERVFSKTFTKRSFASLLDEEFMSKSILEGMVFDK… |
| A0A6C9G4T6 | 5-158 | None |
| A0A291QVH7 | 7-135 | None |
| A0A4R1A1S8 | 39-174 | None |
| A0A0A2MJN2 | 25-173 | None |
| A0A1J5L4N8 | 35-167 | None |
| A0A2K1DWD5 | 39-187 | None |
| A0A1H9LHT3 | 15-150 | None |
| J9C6M4 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.