DPCstruct | MC28149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 212 ± 23 aa |
| Standard deviation of domain lengths | 23.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S3TB85 | 93-292 | SYEDDIEDDPEDEAGATEPRRRELDAGTRAILREEAEREAAVRRAEREALETQPDLGLDLGQEDRGAAAKRRMAKLRGEPDPPPDPR… |
| A0A1H8AE10 | 57-274 | DVSPVARQNVAGQNVAGQNAAGQPAGGLGDAASMTPPPLAPRRGLDESLLAVLREEADRETAVRRSETPKSEPRALESQTDLGLEET… |
| A0A1H9G458 | 86-310 | None |
| A0A848XF34 | 2-199 | None |
| A0A3S1ALQ7 | 138-340 | None |
| A0A2Z4PB02 | 83-257 | None |
| A0A520ZP59 | 8-197 | None |
| A0A0F8WRN6 | 1-200 | None |
| A0A4V2NJP2 | 1-206 | None |
| A0A085TZ34 | 70-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.