DPCstruct | MC2814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 187 ± 18 aa |
| Standard deviation of domain lengths | 18.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20388 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8FCI8 | 136-323 | RASGSPEIVAGVSAITPSSYYAEPEVSVRVREQFGQLLAKEAGPADAARLAEAVTQRDTVRDWAEIVKGDGLRPGDIADVMASYWIL… |
| A0A4Q4BQ19 | 2-176 | PAGPGVQAPAFLYQSTSALRRSASEAYVARVQQRNPAAAALISSELGRHDYDRIYTGIVAPYGYRPNDAADGLAAYTLLGWLIANGQ… |
| A0A841M2M5 | 53-197 | None |
| A0A4V1ZKF7 | 44-230 | None |
| A0A848FGE0 | 12-202 | None |
| A0A3M6RJ26 | 19-206 | None |
| A1EBU9 | 290-481 | None |
| A0A845ATH4 | 50-245 | None |
| A0A0S9QM85 | 1-169 | None |
| A0A285QX63 | 94-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.