DPCstruct | MC28137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 183 ± 23 aa |
| Standard deviation of domain lengths | 22.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3RBF3 | 5-166 | NENKILKQNYTMLERRIRAESRTSSQQSLPTLPDDDPVYEIPPNNERCLTGNGTNCLKVTVSVDFSGLLRPRSLAGEVSIGFIHLPS… |
| A0A2G9TXY9 | 288-451 | HENKQLKSDMSRLLAGRGSRASSQASIPMLGDEDPVYEAPPSSSSGSYSSKRSSGCNSVKVTVNVDLRGVISNAICPDNEIIIGFLA… |
| A0A7I4NLM6 | 1510-1671 | None |
| A0A0N4VSN6 | 331-494 | None |
| A0A0K0E488 | 964-1169 | None |
| S4RJ67 | 872-1098 | None |
| Q80TN7 | 1814-1993 | None |
| A0A0M3IZW9 | 284-493 | None |
| A0A060XR40 | 67-238 | None |
| A0A1I7XU67 | 84-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.