DPCstruct | MC28133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 133 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 58.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8C3B1 | 182-312 | MYFNKVVLPDMDYVEDFVDFLIDAELNDLPVLKRACERYLCGELNTKKELMTSLILDLFFIAMVFRLPVMKSMTLTELCDRYYEMED… |
| A0A0K0E7V4 | 471-588 | MEFIEDFADFLIDAEINDLPVLKRACERYLCTELITKKDIKTSIILDFLFLSMVFQLPVMKSMTLCESTERYKEIRDVEGLMKLEEY… |
| A0A6V7W924 | 483-620 | None |
| A0A0R3RJX6 | 39-165 | None |
| W2T8I9 | 100-235 | None |
| A0A1I7TKN9 | 14-156 | None |
| A0A1I7SA93 | 839-966 | None |
| A8Y1F4 | 587-727 | None |
| A0A3P7PRM5 | 171-300 | None |
| A0A3P7IKE7 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.