DPCstruct | MC28132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 13.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3R6K0 | 9-118 | NTFNKISELLVAIQRYLSQGPCKEAAKMLKDEIEKNQLLPMRYDYKGKAHQRSFDDFERSVIPLNVSLVSLIERLGSLITVAVPIPL… |
| A0A6P9F6V2 | 10-112 | ELRSELYFLIARFLEDGPCQQAAQVLIRKVAEKELLPCRTDWTGKEHPRTYQNLVKYYRHLAPDHLLQICHRLGPLLEQEIPQSVPG… |
| A0A016TI48 | 114-235 | None |
| A0A1D6FEL1 | 51-175 | None |
| A0A668VTX8 | 4-96 | None |
| A0A3Q0IYQ4 | 9-115 | None |
| A0A194QZE8 | 4-103 | None |
| A0A178W1S7 | 30-172 | None |
| A0A2I3S330 | 16-92 | None |
| A0A1B6MQ82 | 7-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.