DPCstruct | MC28131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 166 ± 33 aa |
| Standard deviation of domain lengths | 33.34 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 86.97 |
| Assigned Pfam label(s) | PF17777- PF00428- PF00466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3JNL1 | 7-170 | KDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKKLRGEVGLLFTNRTKEEVNEWFMKYTEMDYARAGNKATFTVSLDSG… |
| A0A0R3R480 | 2-171 | RSTKFIEIRQKYKNNSHFFYGKNNVMAIALGKTSSTEYARELNKISGLLKGECGLMFTNDDHDSVKKYFDELYMSDFARCGQTAIST… |
| L9KBI5 | 103-273 | None |
| A0A1D2N0W0 | 662-819 | None |
| A0A4Y7J1N6 | 209-434 | None |
| A0A7R9YF52 | 2-131 | None |
| A0A2K5QKD5 | 8-155 | None |
| A0A5B6WM85 | 2-121 | None |
| A0A832UQK8 | 19-205 | None |
| A0A1W0E397 | 5-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.