DPCstruct | MC28130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 253 ± 38 aa |
| Standard deviation of domain lengths | 37.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3R442 | 17-212 | IRVEDATEHCGNIARKYHLKRVTVEDKNPSPAGLSEPLFVTETLMDIERLLYEIMPVVVSRMYGNYKYEGLIDYEIDLIDCEQYIAN… |
| A0A1A8R5E3 | 124-333 | LHYRLQQPGAADQSSGGVGGYEDDKVQLPFTVTDLKGRNLQLVTEPHDRQSVCVEQLTLDFEYLINEVIRNDVVWAPQFCSFSDYDV… |
| A0A1B6CNS5 | 191-485 | None |
| A0A423T8D8 | 709-996 | None |
| A0A7D9DGI2 | 264-540 | None |
| A0A7M5WT94 | 106-354 | None |
| A0A2G8LAE1 | 425-682 | None |
| A0A6G0TYN4 | 450-741 | None |
| A0A833T1I6 | 200-409 | None |
| A0A6A4X3Y5 | 396-669 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.