DPCstruct | MC28128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 360 ± 50 aa |
| Standard deviation of domain lengths | 49.59 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.27 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | PF12030- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3R3T4 | 88-412 | EEMQSMWFGGEYITETFENSSSHYQKKRQKRWWNAYLLIYEKISATGASVVSSSVELTTSCSSTQPSHSSSNSPLSLDKKIGAMSIS… |
| A0A1B6C7R0 | 16-361 | MIDCDYGTKAVCTKYQLSGIVVHSGQASGGHYYSYILHRQGDGSSKWYKFDDGDVSECKMEDEEEMKTQCFGGDYMGEVFDHILKRM… |
| A0A5S6PIW4 | 1052-1441 | None |
| A0A7R9DNS9 | 1-327 | None |
| A0A3P7DZR8 | 538-942 | None |
| F1P910 | 138-490 | None |
| A0A820BG72 | 1-292 | None |
| A7F7K3 | 1-467 | None |
| A0A821C0I3 | 2-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.