DPCstruct | MC28117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 12.14 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2S1N2 | 1-102 | MKMRCECGEIISDNTDYLPYKAFLIADEDWFGVADAIDEITSEVASGRTTILAAETAVRVVLNKKSRTMYQCSKCGRLLVADWQHNR… |
| K9Q642 | 1-120 | MPKIRCLCDEVINLSVIPNRQEFKLIWEPKIEQIIDSLVNAHQQAASNEDFEKQAYDLFYLKKPKFPQVYECPNCKRLIVFASAADK… |
| A0A2P8D7B8 | 1-83 | None |
| A0A089KW96 | 1-101 | None |
| A0A6L4A6B0 | 1-115 | None |
| A0A1M5PY31 | 1-117 | None |
| A0A7W8MJR9 | 1-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.