DPCstruct | MC28115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 3 aa |
| Standard deviation of domain lengths | 3.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3C8V9 | 3-64 | GSVKVWQEIISLPTWTTGAEDPNPMFLEKRVYQGSSGSVYPYGVIDTLTGEREMRDYQAVWM |
| R4YD87 | 3-64 | GSVKVWQEIISLPTWTTGAEDPNPMFLEKRVYQGSYGSVYPYGVIDTLTGEREMRDYQAVWM |
| A0A2V4VAZ2 | 9-69 | None |
| A0A2V9R2N6 | 9-68 | None |
| A0A377DPV7 | 1-63 | None |
| A0A1G7F8Z2 | 23-92 | None |
| A0A7G2IVN2 | 3-64 | None |
| K1RLY2 | 1-63 | None |
| A0A822PIE1 | 1-56 | None |
| A0A844EPB9 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.