DPCstruct | MC28114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 230 ± 36 aa |
| Standard deviation of domain lengths | 35.69 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5SQR1 | 37-228 | AYAILRDTVLTYKKRVISLFDDFQKLGYEFNIPFEKFIPVFSLPDSRNNVYAAFEYDVASLERLVKICEKFDITSDMMDADTKLIYD… |
| W6TKT4 | 18-271 | ISCSAVRKDNFGDVHKVVLSKHLDNFGLLNLDSYTTESLDLYRDLPMPITPYESLKRKVQEFRISLDVGSKGFDKSKFDGMFHGFNH… |
| B5RRW4 | 23-264 | None |
| W5T262 | 11-184 | None |
| W5SB78 | 16-258 | None |
| W5SAK7 | 4-177 | None |
| T1ECK9 | 23-309 | None |
| T1EC99 | 99-332 | None |
| T1EC81 | 106-354 | None |
| T1EC86 | 46-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.