DPCstruct | MC28112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 105 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6TFN6 | 1-113 | MLSIHSWLVSILFLFVGLMGCNSGGVSGEGKGEEGKGRKGDGSVIDLKVVSNKIRYAVEFAESVKEVHTLVKSVDELAKAIGKKVGA… |
| A0A218PEY5 | 1-97 | TAPKDGQAAKSDGTILDLATITKNITDAVAFAKDVKDVHTLVKSIDELAKAIKKKIQAGGLQDDTDNLNGTLLAGAYQIMADADSKL… |
| I0FF10 | 30-137 | None |
| A0A172XDA8 | 6-106 | None |
| W5SXM5 | 11-114 | None |
| W5SL69 | 2-107 | None |
| A0A218PFA2 | 1-109 | None |
| W5T7U6 | 7-106 | None |
| W5STJ4 | 9-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.