DPCstruct | MC28111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 206 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U6J5Z4 | 1-230 | MATWMAHFRIAENLLNRGLLASEKEFVVGNIGPDCGLPDPETGIFYPDKIATHFKDDGKINPELFWEKYIQEEDNFTDPRSSFYLGY… |
| R5HEV2 | 1-196 | MASAVIHLCVANEYLKKTNKKSLELLIGSIAPDIAKYIGVHKMETHFQEKNDDIPDLKLFLNKYSNYLSDDFVLGYYIHLYTDYLWF… |
| A0A3D2G282 | 1-222 | None |
| A0A285D6I3 | 1-196 | None |
| A0A1D9P505 | 1-192 | None |
| A0A0B4RBW7 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.